FOXO4-DRI Peptide (10 mg)

Price range: €600.00 through €5,000.00

FOXO4-DRI Peptide (10 mg) is supplied exclusively as a research-grade laboratory compound for qualified scientific investigation.

FOXO4-DRI Peptide (10 mg)

FOXO4-DRI Peptide (10 mg) is a research-grade synthetic D-retro-inverso peptide designed for laboratory investigations into cellular senescence, apoptosis, aging biology, and tissue homeostasis. Researchers utilize FOXO4-DRI in preclinical studies to explore its ability to disrupt the interaction between the FOXO4 transcription factor and p53, allowing selective apoptosis of senescent cells in controlled experimental models.

FOXO4-DRI has become a widely studied senolytic peptide in aging research due to its potential role in eliminating senescent cells that contribute to the senescence-associated secretory phenotype (SASP). It is commonly used in cell culture studies, mechanistic pathway research, oncology models, pulmonary fibrosis investigations, regenerative medicine research, and age-related disease models.

For Research Use Only. Not for human use.

For Research Use Only. Not for human use.


FOXO4-DRI Peptide Research Overview

FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide engineered to interfere with the interaction between FOXO4 and p53, two proteins involved in cellular survival and apoptosis. In laboratory models, disrupting this interaction allows p53-mediated apoptosis of senescent cells while preserving non-senescent cells under specific experimental conditions.

Because senescent cells accumulate during aging and release pro-inflammatory factors known as the Senescence-Associated Secretory Phenotype (SASP), FOXO4-DRI is frequently investigated in research involving:

  • Cellular senescence
  • Senolytic pathway studies
  • Aging biology
  • Tissue homeostasis
  • Apoptosis signaling
  • p53 pathway research
  • Fibrosis models
  • Cancer microenvironment studies
  • Regenerative medicine
  • Mechanistic drug discovery

Research involving FOXO4-DRI should always remain within validated institutional laboratory protocols.


Product Specifications

Specification Details
Product FOXO4-DRI Peptide
Strength 10 mg
Peptide Type Synthetic D-Retro-Inverso Peptide
Sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids)
Molecular Formula C228H388N86O64
Molecular Weight 5358 g/mol
CAS Number 2460055-10-9
Synonyms Proxofim, FOXO4a, AFX, FOXO4-DRI
Appearance Lyophilized Powder
Grade Research Grade
Purity ≥99% (HPLC Tested)
Quality Verification LC-MS, HPLC, COA Available
Intended Use Laboratory Research Only

Research Applications

FOXO4-DRI Peptide is commonly investigated in laboratory studies involving:

  • Senescent cell biology
  • Senolytic mechanisms
  • Cellular apoptosis
  • p53 signaling pathways
  • Tissue regeneration
  • Pulmonary fibrosis models
  • Oncology research
  • SASP investigations
  • Aging-related disease models
  • Mechanistic pathway analysis

FOXO4-DRI is not approved for clinical, therapeutic, veterinary, or diagnostic use.


FOXO4-DRI Benefits

Secondary Keyword: FOXO4-DRI benefits

In preclinical research, FOXO4-DRI has attracted significant scientific interest because of its role in senescent cell biology.

Published laboratory studies have investigated FOXO4-DRI for its potential involvement in:

  • Selective removal of senescent cells
  • Cellular apoptosis mechanisms
  • Tissue homeostasis research
  • Senescence-associated secretory phenotype (SASP) studies
  • Aging biology
  • Fibrosis research
  • Tumor microenvironment investigations
  • Testicular aging models
  • Cartilage regeneration research

These findings originate exclusively from laboratory and animal research and should not be interpreted as evidence of safety or effectiveness in humans.


Foxo4 DRI Peptide 10 mg Benefits

Secondary Keyword: Foxo4 dri peptide 10 mg benefits

Researchers choose the 10 mg presentation because it provides sufficient material for pilot studies, assay optimization, and multi-step laboratory experiments.

Potential research applications include:

  • Senolytic pathway investigations
  • Mechanistic apoptosis studies
  • Cellular aging models
  • In vitro cell culture research
  • Tissue regeneration studies
  • Drug discovery screening
  • Experimental fibrosis models

This product is supplied solely for laboratory research.


Foxo4 DRI Peptide 10 mg Price

Secondary Keyword: Foxo4 dri peptide 10 mg price

The price of FOXO4-DRI Peptide (10 mg) varies depending on factors including:

  • Research-grade manufacturing
  • Third-party purity testing
  • Batch quality
  • Certificate of Analysis (COA)
  • Inventory availability
  • Production standards

Current pricing is displayed on the product page at the time of purchase.


Foxo4 DRI Peptide 10 mg Dosage

Secondary Keyword: Foxo4 dri peptide 10 mg dosage

Because FOXO4-DRI is not approved for human or veterinary use, there is no established therapeutic dosage.

Research concentrations are selected according to:

  • Published scientific literature
  • Experimental objectives
  • Cell type
  • Laboratory methodology
  • Assay validation
  • Institutional SOPs

Each research laboratory should independently determine appropriate experimental concentrations.


FOXO4-DRI Dosage

Secondary Keyword: FOXO4-DRI dosage

FOXO4-DRI is intended exclusively for laboratory research.

There are no FDA-approved dosing recommendations for humans or animals. Experimental concentrations should be scientifically justified within each research protocol.


FOXO4-DRI Dosage Per Day

Secondary Keyword: FOXO4-DRI dosage per day

There is no approved daily dosage for FOXO4-DRI because this compound is not intended for human administration.

Laboratory protocols vary depending upon:

  • Cell models
  • Animal models
  • Experimental objectives
  • Study duration
  • Detection methods

FOXO4-DRI Peptide Protocol

Secondary Keyword: FOXO4-DRI peptide protocol

Researchers typically follow validated institutional protocols when working with FOXO4-DRI.

General laboratory workflow includes:

  • Verify lot identity
  • Review Certificate of Analysis
  • Record batch documentation
  • Prepare assay buffers
  • Reconstitute according to laboratory SOPs
  • Label aliquots
  • Document storage conditions
  • Minimize freeze-thaw cycles
  • Record experimental variables

Pilot experiments are recommended before expanding to larger studies.


Foxo4 DRI Peptide 10 mg For Sale

Secondary Keyword: Foxo4 dri peptide 10 mg for sale

When sourcing FOXO4-DRI for laboratory research, investigators often prioritize:

  • ≥99% purity
  • Third-party analytical verification
  • Certificate of Analysis (COA)
  • Batch consistency
  • Research-grade manufacturing
  • Reliable documentation
  • Secure laboratory packaging

Every batch is intended to support reproducible preclinical research.


Laboratory Handling

Receiving

Upon delivery:

  • Verify product identity
  • Confirm lot numbers
  • Inspect vial integrity
  • Compare shipment documentation
  • Retain packaging until verification is complete

Reconstitution

Researchers should:

  • Follow institutional SOPs
  • Validate solvent compatibility
  • Record batch identifiers
  • Label aliquots clearly
  • Prepare buffers before opening the vial

Storage

For maximum peptide stability:

  • Store sealed in the original vial.
  • Protect from moisture, humidity, and direct light.
  • Maintain long-term storage at -4°F (-20°C) or colder.
  • Refrigerate at approximately 39°F (4°C) for short-term laboratory use.
  • Avoid repeated freeze-thaw cycles.

Certificate of Analysis (COA)

Every batch of FOXO4-DRI Peptide includes or is supported by a Certificate of Analysis (COA) for batch verification and quality assurance.

Independent laboratory testing typically includes:

  • High-Performance Liquid Chromatography (HPLC) purity testing (typically ≥99%)
  • Liquid Chromatography-Mass Spectrometry (LC-MS) identity confirmation
  • Molecular weight verification
  • Residual solvent analysis
  • Chemical contaminant screening
  • Sterility and endotoxin testing where applicable

Third-party testing helps researchers verify molecular identity and maintain reproducible laboratory workflows.


Why Researchers Choose FOXO4-DRI Peptide

Research laboratories frequently select FOXO4-DRI because it offers:

  • Research-grade purity
  • Third-party analytical testing
  • COA documentation
  • Reliable batch traceability
  • Compatibility with senolytic research
  • Suitability for apoptosis pathway studies
  • Support for aging and regenerative medicine investigations
  • Consistent manufacturing standards

Frequently Asked Questions

What are the benefits of taking 10mg of FOXO4-DRI peptide?

FOXO4-DRI (10 mg) is not intended to be taken by humans. In laboratory research, the 10 mg vial provides sufficient material for studies investigating senescent cell biology, apoptosis, tissue homeostasis, and aging-related pathways. Findings from these studies should not be interpreted as evidence of clinical benefit.


What is FOXO4-DRI treatment used for?

FOXO4-DRI is not an approved medical treatment. In research settings, it is studied as a senolytic peptide to investigate selective elimination of senescent cells and its effects on aging biology, fibrosis, oncology, and tissue regeneration models.


Can FOXO4-DRI peptide increase sperm count?

There is no approved clinical evidence demonstrating that FOXO4-DRI increases sperm count. Some preclinical animal studies have explored its effects on age-related Leydig cell function and testosterone secretion, but these findings are limited to research models and should not be interpreted as human outcomes.


How much does FOXO4-DRI cost?

Pricing depends on factors such as peptide purity, batch testing, manufacturing standards, vial size, and inventory availability. Refer to the product page for the latest pricing on FOXO4-DRI Peptide (10 mg).


What is FOXO4-DRI?

FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53. It is widely investigated in laboratory research involving cellular senescence and apoptosis.


What is FOXO4-DRI used for in research?

Researchers commonly study FOXO4-DRI in:

  • Cellular senescence
  • Senolytic therapies
  • Aging biology
  • Cancer microenvironment models
  • Pulmonary fibrosis research
  • Regenerative medicine
  • Tissue homeostasis
  • Mechanistic pathway investigations

Is FOXO4-DRI FDA approved?

No. FOXO4-DRI has not been approved by the U.S. Food and Drug Administration (FDA) for any therapeutic, diagnostic, or medical application.


Is FOXO4-DRI intended for human use?

No. FOXO4-DRI Peptide is supplied strictly for research purposes only and is not intended for human or animal use.


Research Use Disclaimer

For Research Use Only. Not for human use.

FOXO4-DRI Peptide (10 mg) is supplied exclusively as a research-grade laboratory compound for qualified scientific investigation. It is not intended for human or veterinary use and must not be used to diagnose, treat, cure, or prevent any disease. This product has not been evaluated or approved by the U.S. Food and Drug Administration (FDA) for therapeutic or clinical applications.

Quantity

3 bottles, 5 bottles, 10 bottles, 20 bottles, 50 bottles

FOXO4-DRI Peptide (10 mg)FOXO4-DRI Peptide (10 mg)
Price range: €600.00 through €5,000.00Select options